DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and BTF3L4

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_689478.1 Gene:BTF3L4 / 91408 HGNCID:30547 Length:158 Species:Homo sapiens


Alignment Length:153 Identity:103/153 - (67%)
Similarity:115/153 - (75%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65
            ||.|||.|||||||||||||.|||||:||.|...||||||||||||:||.|.||||||:||:|||
Human     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAA 130
            ||||||||.||||..||||||||.|.|.||||:||||:|||...:..|:|||.:...:.....|.
Human    66 VIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAP 130

  Fly   131 GSSAADAGDDDVPDLVENFEEVA 153
            .....|..|||||||||||:|.:
Human   131 KPEDIDEEDDDVPDLVENFDEAS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 43/51 (84%)
BTF3L4NP_689478.1 NAC_BTF3 4..120 CDD:409234 87/115 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..158 14/32 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159255
Domainoid 1 1.000 95 1.000 Domainoid score I7416
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3781
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55040
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm8606
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - LDO PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 1 1.000 - - X613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.