DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and EGD1

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_015288.1 Gene:EGD1 / 856070 SGDID:S000005958 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:57/146 - (39%)
Similarity:79/146 - (54%) Gaps:10/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLKKLQAQVRIGGKGTPRRK--KKIVHSTPAT-DDKKLQSSLKKLSVNTIPGIEEVNIIKNDGTV 66
            ||:||.|..::||   .|||  ||...|..|. ||.||||.|.||...||..:.|.|..|:||.|
Yeast    10 KLQKLSANNKVGG---TRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANFFKDDGKV 71

  Fly    67 IHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAAG 131
            :|||....|.:...||....|..:.|.:.::.|||::||||:.|..|.:||.::....    |..
Yeast    72 MHFNKVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQLAAQMEKHE----AKA 132

  Fly   132 SSAADAGDDDVPDLVE 147
            .:.|:..|:.:|:|||
Yeast   133 PADAEKKDEAIPELVE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 22/51 (43%)
EGD1NP_015288.1 NAC_BTF3 9..125 CDD:409234 50/117 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3059
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I1534
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55040
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm9232
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - LDO PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 1 1.000 - - X613
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.