DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and AT1G73230

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_177466.1 Gene:AT1G73230 / 843657 AraportID:AT1G73230 Length:165 Species:Arabidopsis thaliana


Alignment Length:171 Identity:85/171 - (49%)
Similarity:114/171 - (66%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65
            ||.|||.|:...||.|||||.|||||.||.|..||||:|||:||::.||:||.||||||.|:| .
plant     1 MNREKLMKMANTVRTGGKGTVRRKKKAVHKTTTTDDKRLQSTLKRVGVNSIPAIEEVNIFKDD-V 64

  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKS-GAGGA 129
            ||.|.|||.|||:..||:.::|..:.|.:.:::|.|::||||.:::.|||||.:...:: |||..
plant    65 VIQFINPKVQASIAANTWVVSGTPQTKKLQDILPQIISQLGPDNLDNLKKLAEQFQKQAPGAGDV 129

  Fly   130 AGSSAADAGDDDVPDLV--ENFEEVAIADTKEEKSGEVAAS 168
            ..:...:..||||||||  |.||..|     .|::.:.|||
plant   130 PATIQEEDDDDDVPDLVVGETFETPA-----TEEAPKAAAS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 29/51 (57%)
AT1G73230NP_177466.1 NAC_BTF3 4..119 CDD:409234 64/115 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3432
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37453
Inparanoid 1 1.050 159 1.000 Inparanoid score I1648
OMA 1 1.010 - - QHG55040
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm973
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X613
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.