DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and Btf3l4

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_011238912.1 Gene:Btf3l4 / 70533 MGIID:1915312 Length:188 Species:Mus musculus


Alignment Length:153 Identity:103/153 - (67%)
Similarity:115/153 - (75%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65
            ||.|||.|||||||||||||.|||||:||.|...||||||||||||:||.|.||||||:||:|||
Mouse    31 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 95

  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAA 130
            ||||||||.||||..||||||||.|.|.||||:||||:|||...:..|:|||.:...:.....|.
Mouse    96 VIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAP 160

  Fly   131 GSSAADAGDDDVPDLVENFEEVA 153
            .....|..|||||||||||:|.:
Mouse   161 KPEDIDEEDDDVPDLVENFDEAS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 43/51 (84%)
Btf3l4XP_011238912.1 NAC 68..120 CDD:376630 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849623
Domainoid 1 1.000 95 1.000 Domainoid score I7401
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3773
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55040
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm8840
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - LDO PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 1 1.000 - - X613
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.