DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and BTF3

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001032726.1 Gene:BTF3 / 689 HGNCID:1125 Length:206 Species:Homo sapiens


Alignment Length:153 Identity:97/153 - (63%)
Similarity:109/153 - (71%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65
            ||.|||.|||||||||||||.|||||:||.|...||||||.|||||.||.|.||||||:..|.||
Human    50 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGT 114

  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAA 130
            ||||||||.||||..|||.||||.|.|.:|||:|.||.|||...:..|::|| |...|....|.|
Human   115 VIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLA-EALPKQSVDGKA 178

  Fly   131 GSSAADAGDDDVPDLVENFEEVA 153
            ..:..:..||:||||||||:|.:
Human   179 PLATGEDDDDEVPDLVENFDEAS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 39/51 (76%)
BTF3NP_001032726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
NAC 87..140 CDD:376630 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..206 14/32 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10888
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37453
Inparanoid 1 1.050 200 1.000 Inparanoid score I3781
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55040
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm8606
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 1 1.000 - - X613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.