DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and btf3l4

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001011243.1 Gene:btf3l4 / 496686 XenbaseID:XB-GENE-948236 Length:158 Species:Xenopus tropicalis


Alignment Length:153 Identity:100/153 - (65%)
Similarity:115/153 - (75%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65
            ||.|||.|||||||||||||.|||||:||.|...||||||||||||:||.|.||||||:||:|||
 Frog     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAA 130
            ||||||||.||||..||||||||.|.|.||||:||||:|||...:..|:|||.:...:.....|:
 Frog    66 VIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAS 130

  Fly   131 GSSAADAGDDDVPDLVENFEEVA 153
            .....:..|||||:||.||:|.:
 Frog   131 KPEDIEEEDDDVPELVGNFDEAS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 43/51 (84%)
btf3l4NP_001011243.1 NAC 38..91 CDD:376630 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..158 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7198
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3723
OMA 1 1.010 - - QHG55040
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 1 1.000 - - X613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.