DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and betaNACtes6

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_727778.1 Gene:betaNACtes6 / 318107 FlyBaseID:FBgn0052598 Length:262 Species:Drosophila melanogaster


Alignment Length:164 Identity:49/164 - (29%)
Similarity:75/164 - (45%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65
            |:.:||||::..|||||||:.|||.| .:.:||..:|::|:.|..|.:..|..|:||.|...:..
  Fly     1 MDFKKLKKMEEAVRIGGKGSMRRKHK-RNPSPAVVEKRVQAELAMLPLRNIGEIQEVTIEFTNSR 64

  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAA 130
            .:....||.|.:.|.:.|.::|                     |:         :...|.||.:.
  Fly    65 EVVLTMPKVQGTPPNSFFVVSG---------------------DL---------VRKSSTAGPSK 99

  Fly   131 GSSAADAGDDDVPDLVENFEEVAIADTKEEKSGE 164
            .:.||:|....:|......|  |.:|.|.| |||
  Fly   100 VAKAANAPKAPMPPKPPKPE--AFSDKKPE-SGE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 14/51 (27%)
betaNACtes6NP_727778.1 NAC 37..87 CDD:280093 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.