DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bic and icd-1

DIOPT Version :9

Sequence 1:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_495336.1 Gene:icd-1 / 174090 WormBaseID:WBGene00002045 Length:161 Species:Caenorhabditis elegans


Alignment Length:162 Identity:98/162 - (60%)
Similarity:122/162 - (75%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEKLKKLQAQ---VRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDG 64
            ||::||||||   ||||||||||||||::|.|.|.|||||||:||||||..||||||||:||:||
 Worm     7 AERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDG 71

  Fly    65 TVIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGA 129
            |||||||||.|.|:|.|||::||..:||.||||:||||.||||:.:..|||||..: :|.|..| 
 Worm    72 TVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV-TKLGPDG- 134

  Fly   130 AGSSAADAGDDDVPDLVENFEEVAIADTKEEK 161
                  ...|:|||:||.:|:..:..:||.::
 Worm   135 ------KGEDEDVPELVGDFDAASKNETKADE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bicNP_476853.1 NAC 38..90 CDD:280093 39/51 (76%)
icd-1NP_495336.1 NAC 45..96 CDD:280093 39/50 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4804
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I2559
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55040
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - otm14572
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - LDO PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 1 1.000 - - X613
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.