DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bel and CG32344

DIOPT Version :9

Sequence 1:NP_001262379.1 Gene:bel / 45826 FlyBaseID:FBgn0263231 Length:801 Species:Drosophila melanogaster
Sequence 2:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster


Alignment Length:374 Identity:113/374 - (30%)
Similarity:186/374 - (49%) Gaps:26/374 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 EIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQS 368
            |:|: .:....|..|||:|:..||:|:.|||::|.|:|||||||.||:|:..   :|....|.:.
  Fly    49 ELIK-GITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFE---KLQRREPTKG 109

  Fly   369 TRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIV 433
            .|          .|:|:||||||.|.::..|:......::..::.||::...|...:.....:||
  Fly   110 AR----------ALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIV 164

  Fly   434 ATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSATFP 498
            |||||...:.....:.|.:|.::|.|||||:.:|||..|:...:.:|    ...|||:|||||.|
  Fly   165 ATPGRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRL----PSSRQTVMFSATLP 225

  Fly   499 KQIQELASDFLSNYIFLAVGRVGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDSLTL 563
            |.:.|.|...|::.:.:.:.......:.:....|:....|:.:.|:.||..:     ....|.|:
  Fly   226 KLLVEFARAGLNDPVLIR
LDVESKLPDALALKFLYCRPDDRYTALVVLLKYV-----IPVQSQTV 285

  Fly   564 IFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHV 628
            :|..|:...:.:...|.:......|::.......|:.....|.:....:|:.|.|||||:|||.:
  Fly   286 VFAGTQHHVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSL 350

  Fly   629 KHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKNRNICSDLLEL 677
            ..|:|...|...:.:|||:||..|.|..|.|.|..:..:   .:.||:|
  Fly   351 DFVVNLHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDD---TAHLLDL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
belNP_001262379.1 DEADc 297..516 CDD:238167 74/211 (35%)
DEXDc 315..529 CDD:214692 72/213 (34%)
Helicase_C 538..654 CDD:278689 31/115 (27%)
CG32344NP_612028.4 DEADc 41..243 CDD:238167 74/211 (35%)
DEXDc 54..243 CDD:214692 72/205 (35%)
HELICc 263..384 CDD:238034 34/125 (27%)
DBP10CT 666..721 CDD:285373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.