DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and ITK

DIOPT Version :9

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:NP_005537.3 Gene:ITK / 3702 HGNCID:6171 Length:620 Species:Homo sapiens


Alignment Length:461 Identity:172/461 - (37%)
Similarity:273/461 - (59%) Gaps:31/461 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LAPGPEED-----DPQ--LFVALYDFQAGGENQLSLKKGEQVRILSYNKSGEWCEAHSDSGNVGW 255
            |.|.||::     :|:  :.:||||:|.....:|:|::.|:..:|..::. .|......:|:.|:
Human   157 LPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEI-HWWRVQDRNGHEGY 220

  Fly   256 VPSNYV---TPLNSLEKHSWYHGPISRNAAE-YLLSSGINGSFLVRESESSPGQRSISLRYEGRV 316
            |||:|:   :| |:||.:.||:..|||:.|| .||.:|..|:|:||:|.:: |..::|:..:..|
Human   221 VPSSYLVEKSP-NNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTA-GTYTVSVFTKAVV 283

  Fly   317 -------YHYRISEDPDG--KVFVTQEAKFNTLAELVHHHSVPHEGHGLITPLLYPA--PKQNKP 370
                   .||.|.|..|.  :.:|.::..|:::..|:::|.  |.|.||:|.|.||.  .:|..|
Human   284 SENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQ--HNGGGLVTRLRYPVCFGRQKAP 346

  Fly   371 TVFPLSPEPDEWEICRTDIMMKHKLGGGQYGEVYEAVWKRYGNTVAVKTLKEDTMALKDFLEEAA 435
            ....|  ...:|.|..:::....::|.||:|.|:...|.. .:.||:||::|..|:.:||:|||.
Human   347 VTAGL--RYGKWVIDPSELTFVQEIGSGQFGLVHLGYWLN-KDKVAIKTIREGAMSEEDFIEEAE 408

  Fly   436 IMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSY 500
            :|.::.||.||||.|||..:.|..::.|||.||.|.|:||:. |....|..||.|...:..||:|
Human   409 VMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQ-RGLFAAETLLGMCLDVCEGMAY 472

  Fly   501 LESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFST 565
            ||....|||||||||||||:|:::||:|||:.|.:.||.||:..|.|||:||.:||..:::::|:
Human   473 LEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSS 537

  Fly   566 KSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDR 630
            |||||:||||:||:.:.|..||.....::|...:..|:|:.:|......||.:|..||:....||
Human   538 KSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDR 602

  Fly   631 PTFKSI 636
            |.|..:
Human   603 PAFSRL 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784 16/56 (29%)
SH2_ABL 268..363 CDD:198189 34/104 (33%)
PTKc_Abl 382..644 CDD:270645 109/255 (43%)
Pkinase_Tyr 389..640 CDD:285015 107/248 (43%)
FABD 1584..1723 CDD:197885
ITKNP_005537.3 PH_Btk 7..148 CDD:269944
SH3_ITK 174..229 CDD:212841 16/55 (29%)
SH2_Tec_Itk 232..340 CDD:198259 38/110 (35%)
PTKc_Itk 358..613 CDD:133243 108/253 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1047190at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.