DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and Bmx

DIOPT Version :9

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:NP_001102486.1 Gene:Bmx / 367786 RGDID:1565643 Length:655 Species:Rattus norvegicus


Alignment Length:457 Identity:168/457 - (36%)
Similarity:264/457 - (57%) Gaps:34/457 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PEEDDPQLFVALYDFQAGGENQLSLKKGEQVRILSYNKSGEWCEAHSDSG-NVGWVPSNYVTPLN 265
            |.||.|..:            |:...|.|: .|...|:......:||.|. :.|:..|:......
  Rat   218 PREDCPDWW------------QIRKPKSEE-DIARSNQLERNIVSHSPSKMSWGFPESSSSEEEE 269

  Fly   266 SLEKHSWYHGPISRNAAEYLL-SSGINGSFLVRESESSPGQRSISL------RYEGRVYHYRISE 323
            :|:.:.|:.|.|||:.:|.|| ..|..|:|:||.| |..|..::||      ..:|.|.||.:..
  Rat   270 NLDAYDWFAGNISRSQSEQLLRQKGKEGAFMVRNS-SQMGMYTVSLFSKAVNDKKGTVKHYHVHT 333

  Fly   324 DPDGKVFVTQEAKFNTLAELVHHHSVPHEGHGLITPLLYP-APKQNKPTVFPLSPEPDE--WEIC 385
            :.:.|:::.:...|:::.:|:|:|.  |...|:||.|.:| :.|.||   .|:|.....  ||:.
  Rat   334 NAENKLYLAENYCFDSIPKLIHYHQ--HNSAGMITRLRHPVSTKANK---VPVSVALGSGIWELK 393

  Fly   386 RTDIMMKHKLGGGQYGEVYEAVWK-RYGNTVAVKTLKEDTMALKDFLEEAAIMKEMKHPNLVQLI 449
            |.:|.:..:||.||:|.|....|| :|  :||||.:||..|:..:|.:||..|.::.||.||:..
  Rat   394 REEIALLKELGSGQFGVVQLGKWKGQY--SVAVKMIKEGAMSEDEFFQEAQTMMKLSHPKLVKFY 456

  Fly   450 GVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAAR 514
            |||:::.|.||:||::::|.||::|::.|: .|::..||.|...:..||::|||..:||||||||
  Rat   457 GVCSKKYPIYIVTEYITNGCLLNYLKNHGK-GLESSQLLEMCYDVCEGMAFLESHQFIHRDLAAR 520

  Fly   515 NCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEI 579
            ||||..:..|||:|||:.|.:.||.|.:..|.|||:||:|||...|.|:|:||||||||:|:||:
  Rat   521 NCLVDSDLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEV 585

  Fly   580 ATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALEHMF 644
            .:.|..||...|.::|..|:.:|:|:.||......:|.:|..||......||||:.:..|:|.:.
  Rat   586 FSLGKQPYDLYDNSEVVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLSAIEPLR 650

  Fly   645 QE 646
            ::
  Rat   651 EQ 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784 10/54 (19%)
SH2_ABL 268..363 CDD:198189 32/101 (32%)
PTKc_Abl 382..644 CDD:270645 115/262 (44%)
Pkinase_Tyr 389..640 CDD:285015 110/251 (44%)
FABD 1584..1723 CDD:197885
BmxNP_001102486.1 PH_Btk 25..151 CDD:269944
PH 27..115 CDD:278594
SH2_Tec_Bmx 269..374 CDD:198262 34/107 (32%)
PKc_like 392..647 CDD:304357 112/257 (44%)
Pkinase_Tyr 397..646 CDD:285015 110/251 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1047190at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.