DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and Grap

DIOPT Version :10

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:XP_063125579.1 Gene:Grap / 363616 RGDID:1306884 Length:240 Species:Rattus norvegicus


Alignment Length:158 Identity:57/158 - (36%)
Similarity:86/158 - (54%) Gaps:30/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VALYDFQAGGENQLSLKKGEQVRILSYNKSGEWCEAHSDSGNVGWVPSNYVTPLNSLEKHSWYHG 275
            ||||:|||...::|:..||:.::||:.:....|.:|.. .|..|:||.||:    .::.|.||.|
  Rat     4 VALYNFQATESDELAFNKGDTLKILNMDDDQNWYKAEL-RGAEGFVPKNYI----RVKPHPWYSG 63

  Fly   276 PISRN-AAEYLLSSGINGSFLVRESESSPGQRSISLR-----------------------YEGRV 316
            .|||. |.|.|:.....|:||:||||||||:.|:|::                       |..:|
  Rat    64 RISRQLAEETLMKRNHLGAFLIRESESSPGEFSVSVKSSQNGACSKGGGRSEVLGPPPRSYGDQV 128

  Fly   317 YHYRISEDPDGKVFVTQEAKFNTLAELV 344
            .|:::..:..||.|:.:| |||:|.|||
  Rat   129 QHFKVLREASGKYFLWEE-KFNSLNELV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784 20/51 (39%)
SH2_ABL 268..363 CDD:198189 37/101 (37%)
PTKc_Abl 382..644 CDD:270645
FABD 1584..1723 CDD:197885
GrapXP_063125579.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.