DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and Wsck

DIOPT Version :9

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster


Alignment Length:287 Identity:69/287 - (24%)
Similarity:117/287 - (40%) Gaps:61/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 LGGGQYGEVYEAVWKRYGNTVAVKTLKED----TMALKDF--LEEAAIMKEM-------KHPNLV 446
            :|.|::||:..       ..|:......|    .:.|.|.  ..:|.:::|:       :..:|:
  Fly   499 IGDGRFGEIIT-------GKVSTNDFARDCTLHVLCLDDLNGTTQAQLLRELRQLSQLKRQEHLL 556

  Fly   447 QLIGVCTREPPFYIITE--FMSHGNLLDFLR----SAGRETLDAVALLYMATQIASGMSYLESRN 505
            ...||......||:|.|  .||....|...|    |....:|....:|....::||.|:||.|..
  Fly   557 DFYGVSASPDWFYLIFEQQRMSLKRKLVESRLMAPSPRLTSLSEQLVLQWIYELASAMNYLSSCQ 621

  Fly   506 YIHRDLAARNCLVGDNKLVKVADFG------LARLMRDDTYTAHAGAKFPIKWTAPEGLAY-NKF 563
            .:||.|.:.:..|..:..:|::.||      :||...|..           :|.|||.|.: :..
  Fly   622 VVHRQLCSHSVFVTSDFKLKLSVFGPLPYMNIARQQPDHN-----------RWLAPEVLRHQHHH 675

  Fly   564 STKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPP----EVYDLMRQCWQ 624
            ||:||||:...:.||....|.:||.....::  .:|.:..|....|..|.    ::|.|:..|||
  Fly   676 STRSDVWSLACVAWECCALGGTPYANAVASN--QQLLEAIRAAVRPAQPAYVYGDLYQLLLNCWQ 738

  Fly   625 WDATDRPTFKSI-----------HHAL 640
            .:.::|.:.:.:           .|||
  Fly   739 LEPSERSSCEDVAFGVRQLMTSPRHAL 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784
SH2_ABL 268..363 CDD:198189
PTKc_Abl 382..644 CDD:270645 69/287 (24%)
Pkinase_Tyr 389..640 CDD:285015 67/285 (24%)
FABD 1584..1723 CDD:197885
WsckNP_733018.1 WSC 42..115 CDD:280068
fn3 130..222 CDD:278470
TyrKc 493..746 CDD:197581 66/266 (25%)
PTKc 497..750 CDD:270623 66/270 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.