DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and Ptk7

DIOPT Version :10

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:NP_001382670.1 Gene:Ptk7 / 301242 RGDID:1310472 Length:1062 Species:Rattus norvegicus


Alignment Length:280 Identity:100/280 - (35%)
Similarity:150/280 - (53%) Gaps:24/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 DEWEICRTDIMMKHKLGGGQYGEVYEAVWKRYG-------NTVAVKTLK-EDTMALKDFLEEAAI 436
            |:....|..:.....||..::|||:.|  |..|       ..|.||:|: :|.....||..|..:
  Rat   779 DKMHFPRASLQPITTLGKSEFGEVFLA--KAQGLDEGATETLVLVKSLQNKDEQQQLDFRREFEM 841

  Fly   437 MKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLR----------SAGRETLDAVALLYMA 491
            ..::.|.|:|:|:|:|....|.|::.|::..|:|..|||          |....|...|||   .
  Rat   842 FGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKNKDEKLKSQPLSTKQKVAL---C 903

  Fly   492 TQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPE 556
            :|:|.||.:|.:..::|:|||||||||...:.|||:..||::.:.:..|.....|..|::|.:||
  Rat   904 SQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPE 968

  Fly   557 GLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKG-YRMERPPGCPPEVYDLMR 620
            .:....|||||||||||||:||:.|:|..|:......:|...|..| .|:.:|.|||.::|.||:
  Rat   969 AVLEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQGDDEVLADLQAGKARLPQPEGCPSKLYRLMQ 1033

  Fly   621 QCWQWDATDRPTFKSIHHAL 640
            :||..:..|||:|..|...|
  Rat  1034 RCWALNPKDRPSFSEIASTL 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784
SH2_ABL 268..363 CDD:198189
PTKc_Abl 382..644 CDD:270645 99/278 (36%)
FABD 1584..1723 CDD:197885
Ptk7NP_001382670.1 Ig_3 25..96 CDD:464046
Ig2_PTK7 120..214 CDD:409417
Ig strand B 138..142 CDD:409417
Ig strand C 151..155 CDD:409417
Ig strand E 175..179 CDD:409417
Ig strand F 189..194 CDD:409417
Ig strand G 201..204 CDD:409417
Ig_3 218..294 CDD:464046
Ig 319..400 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 345..349 CDD:409353
Ig strand E 365..369 CDD:409353
Ig strand F 380..385 CDD:409353
Ig strand G 393..396 CDD:409353
Ig 404..490 CDD:472250
Ig strand B 421..425 CDD:409353
Ig strand C 434..438 CDD:409353
Ig strand E 457..460 CDD:409353
Ig strand F 470..475 CDD:409353
Ig strand G 483..486 CDD:409353
Ig 495..580 CDD:472250
Ig strand B 512..516 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 545..549 CDD:409353
Ig strand F 559..564 CDD:409353
Ig strand G 573..576 CDD:409353
Ig_3 585..660 CDD:464046
PTK_CCK4 782..1055 CDD:133178 99/277 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.