DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and CRKL

DIOPT Version :10

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:NP_005198.1 Gene:CRKL / 1399 HGNCID:2363 Length:303 Species:Homo sapiens


Alignment Length:129 Identity:41/129 - (31%)
Similarity:65/129 - (50%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 NSLEKHSWYHGPISRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRISEDPDGKV 329
            :|.::.:||.||:||..|:..|....:|.||||:|.:.||...:|:....||.||.|:..|:.: 
Human     7 DSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR- 70

  Fly   330 FVTQEAKFNTLAELVHHHSVPHEGHGL-ITPLLYPAPKQNKPTVFPLS-----PEPDEWEICRT 387
            |...:.:|:.|..|:..:.:    |.| .|.|:.|||:...|.:..:|     ...|..|..||
Human    71 FKIGDQEFDHLPALLEFYKI----HYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRT 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784
SH2_ABL 268..363 CDD:198189 31/95 (33%)
PTKc_Abl 382..644 CDD:270645 3/6 (50%)
FABD 1584..1723 CDD:197885
CRKLNP_005198.1 SH2_CRK_like 6..106 CDD:198180 35/103 (34%)
SH3_CRK_N 126..180 CDD:212692 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..234
SH3_CRK_C 237..293 CDD:212693
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.