DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and Abl1

DIOPT Version :10

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:NP_001106174.1 Gene:Abl1 / 11350 MGIID:87859 Length:1142 Species:Mus musculus


Alignment Length:50 Identity:13/50 - (26%)
Similarity:18/50 - (36%) Gaps:15/50 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 AEKAGWK-------INGCDEKSVREFCN--------EVGIERGVLKVWMH 209
            |.:||.|       |||....:..|..|        .|.:.||...:.:|
Mouse   252 ANRAGMKPGDVIIEINGVKVNTSEEIYNAVRTSESLNVVVRRGADLLMLH 301

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity