DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abl and btk

DIOPT Version :9

Sequence 1:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster
Sequence 2:NP_001123732.1 Gene:btk / 100170477 XenbaseID:XB-GENE-6451230 Length:649 Species:Xenopus tropicalis


Alignment Length:504 Identity:188/504 - (37%)
Similarity:282/504 - (55%) Gaps:28/504 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 QQDSGGLGLQGSSLGGGHSSTTSVFESAHRWTSKENLLAPGPEEDDPQL----------FVALYD 215
            |.....:|.|......|...|    |.:.| .|::.|..|.|:|....|          .||:||
 Frog   157 QTAKNAMGCQPLGNANGFIRT----ERSQR-RSRKPLPPPPPQESQKPLPPTPCLSLHKVVAMYD 216

  Fly   216 FQAGGENQLSLKKGEQVRILSYNKSGEWCEAHSDSGNVGWVPSNYVTPL-NSLEKHSWYHGPISR 279
            |.......|.|.|||:..:|.......|..|...:|..|::|.||||.. :.||.:.||...::|
 Frog   217 FTPLNAQDLPLHKGEEYVLLEEGTGNPWLRARDKNGLEGYIPGNYVTEAQDPLEIYEWYSKNMTR 281

  Fly   280 NAAEYLL-SSGINGSFLVRESESSPGQRSISLRY-----EGRVYHYRISEDPDGKVFVTQEAKFN 338
            :.||.|| :....|.|:||:| |..|:.::|: |     ||.:.||.:.|.|..:.::.::..::
 Frog   282 SQAEKLLRAEDKEGGFIVRDS-SKAGKYTVSV-YAKSSGEGIIRHYVVCEAPGNQYYLAEKHLYS 344

  Fly   339 TLAELVHHHSVPHEGHGLITPLLYPAPKQNKPTVFPLSPEPDEWEICRTDIMMKHKLGGGQYGEV 403
            ::.||:.:|.  |...|||:.|.||.....|............|||...|:....:||.||:|.|
 Frog   345 SIPELITYHQ--HNAAGLISRLKYPVCSLRKTAPSTAGLGYGSWEIDPKDLTFLKELGNGQFGVV 407

  Fly   404 YEAVWKRYGNTVAVKTLKEDTMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHG 468
            ....| |..:.||:|.:||.:|:..:|:|||..|.::.|.|||||.||||::.|.:|||||:|:|
 Frog   408 KYGKW-RGQHDVAIKMIKEGSMSEDEFIEEAKCMMKLSHQNLVQLYGVCTKQRPIFIITEFLSNG 471

  Fly   469 NLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLAR 533
            .||::|:.. |..:....||.|.:.:.:.|:||||:.|:|||||||||||..:.:|||:||||:|
 Frog   472 CLLNYLKDL-RGRVSQGDLLSMCSDVCAAMTYLESKQYLHRDLAARNCLVAADGIVKVSDFGLSR 535

  Fly   534 LMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHK 598
            .:.||.||:..|:|||::|::||.|.|.:||:|||||:||||:||:.|.|..||......::..:
 Frog   536 YVLDDEYTSSLGSKFPVRWSSPEVLLYCRFSSKSDVWSFGVLMWEVFTLGRMPYDRFTNNEIVEQ 600

  Fly   599 LDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALEHMFQES 647
            :.:|.|:.||......||.:|..||...|.|||||:.:|:.:..:.::|
 Frog   601 ITRGVRLYRPQNATDRVYSIMVSCWAEKADDRPTFRILHNTILEVLEDS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784 20/63 (32%)
SH2_ABL 268..363 CDD:198189 31/100 (31%)
PTKc_Abl 382..644 CDD:270645 119/261 (46%)
Pkinase_Tyr 389..640 CDD:285015 115/250 (46%)
FABD 1584..1723 CDD:197885
btkNP_001123732.1 PH_Btk 8..167 CDD:269944 2/9 (22%)
SH3_BTK 209..264 CDD:212839 19/54 (35%)
SH2_Tec_Btk 267..370 CDD:198260 34/106 (32%)
PKc_like 388..638 CDD:419665 116/251 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1047190at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.