DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment onecut and ceh-49

DIOPT Version :9

Sequence 1:NP_001259065.1 Gene:onecut / 45816 FlyBaseID:FBgn0028996 Length:1081 Species:Drosophila melanogaster
Sequence 2:NP_504581.1 Gene:ceh-49 / 179001 WormBaseID:WBGene00017538 Length:313 Species:Caenorhabditis elegans


Alignment Length:281 Identity:61/281 - (21%)
Similarity:97/281 - (34%) Gaps:87/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 VIHQQSPSALGNGFQSSSQQAKVSSCASPKGTVSSGGAVSNRIA-----NSSDMEEI--NTKDLA 766
            |:..|........:|..:...:.....||..:.|.....|.:.|     |.:.::||  :.|||.
 Worm    94 VVQTQPSQTRAAPYQKRAPLKQRQEAVSPSSSNSEQSKYSKQEALAMLDNPTIIKEIDFDLKDLC 158

  Fly   767 QRI---SAELKRY---SIP--QAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMYKWLQ 823
            .::   .:|.||:   |.|  |..||:.:|.|:||:||:||.:||||..:..||..::||:.||:
 Worm   159 DKMFVFFSENKRHIEISKPMNQTNFAEHILNRTQGSLSELLNHPKPWDAVSMGRTVYQRMFNWLE 223

  Fly   824 EPEFQRMSALRMAAAQIPQRAPLSSGMSLGSATGPSGSTGTIPTDLDPHGGPTMIQNPLTNESDS 888
            ..|..|....::                                             .|..|...
 Worm   224 MSEDDRAEIWKL---------------------------------------------DLKKEKAD 243

  Fly   889 SPASTPVTSVLVGSVVSCRRKEEPQIEQMPQPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTI 953
            ....||                           :.|.:.:..|:..|...|:...||.......:
 Worm   244 KTTKTP---------------------------RARCLLSQDQKSQLSIFFETNPRPDSLEMKQL 281

  Fly   954 ARQLGLEPTTVGNFFMNARRR 974
            ...|.|..:|:.|:|.|.|||
 Worm   282 GSTLNLCKSTIINYFTNMRRR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
onecutNP_001259065.1 CUT 756..830 CDD:280527 32/83 (39%)
HOX 920..975 CDD:197696 15/55 (27%)
ceh-49NP_504581.1 CUT 149..232 CDD:280527 33/82 (40%)
HOX 248..302 CDD:197696 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2252
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14057
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.