DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment onecut and F41G3.6

DIOPT Version :9

Sequence 1:NP_001259065.1 Gene:onecut / 45816 FlyBaseID:FBgn0028996 Length:1081 Species:Drosophila melanogaster
Sequence 2:NP_495377.1 Gene:F41G3.6 / 174112 WormBaseID:WBGene00018302 Length:296 Species:Caenorhabditis elegans


Alignment Length:119 Identity:24/119 - (20%)
Similarity:44/119 - (36%) Gaps:33/119 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 NREKFIY-----SDHISEGENGPDVNSGTN---WLQMHSEREVRLHM-----PVPAELEARF--- 592
            :|:..:|     .:|....|...:::|.::   ||..|.:.::.:.|     .:..||....   
 Worm    17 SRDIMVYQQARDEEHKKRKEANLELDSDSHVGMWLLCHPDNDLAIAMYTTMVRLAGELSLEVTHD 81

  Fly   593 HISSERRTRLNVPPARGSLSRHLAP--------NAPICPADWKADDWKHSNAGV 638
            .|.:...|.:...|::      |.|        :.|..|.|.:..||   |.||
 Worm    82 DIIAWLGTAIRCHPSQ------LVPRGEAVSIRDKPTLPTDPRGGDW---NTGV 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
onecutNP_001259065.1 CUT 756..830 CDD:280527
HOX 920..975 CDD:197696
F41G3.6NP_495377.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2252
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.