DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and AT1G51330

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_175544.1 Gene:AT1G51330 / 841556 AraportID:AT1G51330 Length:193 Species:Arabidopsis thaliana


Alignment Length:202 Identity:41/202 - (20%)
Similarity:72/202 - (35%) Gaps:78/202 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 INAWAANITQGRLQQLVAPDNV-RSSVMLLTNLIYFNGLWRRQFATTFQGSFFRSKDDQSRAEFM 264
            :|:||...|.|.::.|:.|.:| ..::.:..|.:||.|.|..:|.                    
plant    39 VNSWALRHTNGLIKNLLPPGSVTNQTIKIYGNALYFKGAWENKFG-------------------- 83

  Fly   265 EQTDYFYYTTSEKLKAQILRLPYKGKNSLFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVK 329
                          |:..:..|:...|...||:|:        :|:.|...:|    |....|| 
plant    84 --------------KSMTIHKPFHLVNGKQVLVPF--------MKSYERKYMK----AYNGFKV- 121

  Fly   330 VTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTE 394
            :.:.::..||    |:|.|...:               ..|:       |:|    |.::|:..|
plant   122 LRILQYRVDY----KDTSRQFSI---------------DMDL-------NVL----IEIDEESAE 156

  Fly   395 AYAATVV 401
            |.|||.:
plant   157 AAAATAL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 41/202 (20%)
AT1G51330NP_175544.1 SERPIN <11..>139 CDD:294093 31/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.