DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and SERPINB4

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens


Alignment Length:397 Identity:123/397 - (30%)
Similarity:201/397 - (50%) Gaps:34/397 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQV-------ELANTQT 127
            |:::..|.:.|.:..  .::.:.|:..||.|:...|.::...|...|..|:       ::....|
Human     5 SEANTKFMFDLFQQF--RKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTT 67

  Fly   128 D------IRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEV 186
            :      :....||...::|.|..|.|....:| |.:..|||.:...:..|::...:|.||.:.|
Human    68 EKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYE-LKIANKLFGEKTYQFLQEYLDAIKKFYQTSV 131

  Fly   187 EALDFTN-PEAAADAINAWAANITQGRLQQLVAPDNV--RSSVMLLTNLIYFNGLWRRQF--ATT 246
            |:.||.| ||.:...||:|..:.|..:::.|. ||..  ..:.::|.|.|||.|.|..:|  ..|
Human   132 ESTDFANAPEESRKKINSWVESQTNEKIKNLF-PDGTIGNDTTLVLVNAIYFKGQWENKFKKENT 195

  Fly   247 FQGSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKN 310
            .:..|:.:|:.....:.|.|.:.|.:...|.::|::|.:|||||: |:.||||..::|:..|.:.
Human   196 KEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEK 260

  Fly   311 LENDELKSAQWA----MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADV 371
            |..::|  .:|.    |.|..|.:.||:|..:...:||:|||::|:..||...|.|.|:|....:
Human   261 LTAEKL--MEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGL 323

  Fly   372 AGKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILF 436
            :    ||.:|.||.:.|.|:|.||.|||.|.:......||. |||..|.||:|||.:..|.:|||
Human   324 S----VSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN-EEFCCNHPFLFFIRQNKTNSILF 383

  Fly   437 AGKVHSP 443
            .|:..||
Human   384 YGRFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 120/390 (31%)
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 121/395 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.