DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and SERPINI2

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001012303.2 Gene:SERPINI2 / 5276 HGNCID:8945 Length:405 Species:Homo sapiens


Alignment Length:373 Identity:102/373 - (27%)
Similarity:178/373 - (47%) Gaps:40/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVRE--FYRKTLNSFKKENQLHET 155
            |:|.||..:.|||.::...|....|.|:.    ||..:.:.:..|  |..|:..|...|.:...|
Human    44 NIIFSPLGITLVLEMVQLGAKGKAQQQIR----QTLKQQETSAGEEFFVLKSFFSAISEKKQEFT 104

  Fly   156 LSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAWAANITQGRLQQLVAPD 220
            .::...|:.......::::....|.|:.|.::.:||.:.:|.|:.|:.|....|.|:::.:.:.:
Human   105 FNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQDAKACAEMISTWVERKTDGKIKDMFSGE 169

  Fly   221 NVRS-SVMLLTNLIYFNGLWRRQFATTFQGSFFRSKDDQSRAEFME---------------QTDY 269
            .... :.::|.|.|||.|.|:::|          .|:|.....|.:               :|.|
Human   170 EFGPLTRLVLVNAIYFKGDWKQKF----------RKEDTQLINFTKKNGSTVKIPMMKALLRTKY 224

  Fly   270 FYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLP 333
            .|::.| .|..|:|.|.|||.. ||.::||.....|.::.|.:...::......|:|.:|:::||
Human   225 GYFSES-SLNYQVLELSYKGDEFSLIIILPAEGMDIEEVEKLITAQQILKWLSEMQEEEVEISLP 288

  Fly   334 KFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEAYAA 398
            :|..:.:.:.|:.|.||.:.|||.....|.|:|..::    |.||.:.||....:||.|:||..:
Human   289 RFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSE----VYVSQVTQKVFFEINEDGSEAATS 349

  Fly   399 TVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSPTTQ 446
            |.:.|....  |.|..:|..|.||:|.::...|.:|||.|:|.:|.||
Human   350 TGIHIPVIM--SLAQSQFIANHPFLFIMKHNPTESILFMGRVTNPDTQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 98/365 (27%)
SERPINI2NP_001012303.2 serpinI2_pancpin 23..392 CDD:381042 99/368 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.