DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and SERPINB5

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:389 Identity:102/389 - (26%)
Similarity:185/389 - (47%) Gaps:37/389 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVR 136
            ::..|:..|.|.:.:.|... ||:.||..:...|: ||:....|     :.||....:....||:
Human     7 ANSAFAVDLFKQLCEKEPLG-NVLFSPICLSTSLS-LAQVGAKG-----DTANEIGQVLHFENVK 64

  Fly   137 E--FYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNP-EAAA 198
            :  |..:|:.|...:.....:|.:..:|:.|..:....:|.::.|..|..|:|.:||.:. |...
Human    65 DVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETK 129

  Fly   199 DAINAWAANITQGRLQQLVAPDNVRSSV-MLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQSR 260
            ..||....::|.|..:.::|.::|.... :|:.|..||.|.|.::|  :.|.:..|..:|.|...
Human   130 GQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKP 194

  Fly   261 AEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYAL----NGIHDLVKNLENDELKSAQ 320
            .:.|.....|.....:.:..:|:.||::.|: |:|:|||..:    .|:..:.|.|.::.|  :|
Human   195 VQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESL--SQ 257

  Fly   321 W----AMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIF-EDSASLPGLTRGADVAGKVKVSNI 380
            |    .|...|||:::|||..:...:.|..|.:||::.|| ||::...|::....||    :||:
Human   258 WTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSETKGVA----LSNV 318

  Fly   381 LQKAGINVNEKGTEAYAATVVEI-ENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSP 443
            :.|..:.:.|.|.::.......| ::|       :|.|.:.||::.|....|.||:|.||..||
Human   319 IHKVCLEITEDGGDSIEVPGARILQHK-------DELNADHPFIYIIRHNKTRNIIFFGKFCSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 99/384 (26%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 100/387 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.