DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and SERPINA10

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_016876842.1 Gene:SERPINA10 / 51156 HGNCID:15996 Length:484 Species:Homo sapiens


Alignment Length:389 Identity:106/389 - (27%)
Similarity:173/389 - (44%) Gaps:48/389 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYR 140
            |.:.||:.:....  |.|::.|||.:.|.:..|...|...|:||::              |..:.
Human   122 FGFSLLRKISMRH--DGNMVFSPFGMSLAMTGLMLGATGPTETQIK--------------RGLHL 170

  Fly   141 KTLNSFKKE------NQLHETLSVRTKL--------FTDSFIETQQKFTATLKHFYDSEVEALDF 191
            :.|...|..      ..|.||||...:|        |.....:.::.|....|.::|:|...::|
Human   171 QALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNF 235

  Fly   192 TNPEAAADAINAWAANITQGRLQQLVAPDNVRSSVMLLTNLIYFNGLWRRQFATTFQ--GSFFRS 254
            .|...|...:|.:....|:|::.:|....|..:. ::|.:.|.|.|.|...|...|.  .:|...
Human   236 RNASQAKRLMNHYINKETRGKIPKLFDEINPETK-LILVDYILFKGKWLTPFDPVFTEVDTFHLD 299

  Fly   255 KDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKNSLFVLLPYALNGIHDLVKNLENDELKSA 319
            |....:...|.....|..|..:..:..:|:|||:|..::.|:|...:.....|...|..|.:::.
Human   300 KYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETW 364

  Fly   320 QWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGK-VKVSNILQK 383
            ...|:...::|..|||..|.:..:.|.||.:|:|.||...|.|..|:    ..|: ::||.:||:
Human   365 LRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELS----ATGRNLQVSRVLQR 425

  Fly   384 AGINVNEKGTEAYAATVVEIENKFGGSTAIE---EFNVNRPFVFFIEEESTGNILFAGKVHSPT 444
            ..|.|:|:||||.|..:.||       ||..   ...|:|||.|.|.||::|.:||.|:|.:||
Human   426 TVIEVDERGTEAVAGILSEI-------TAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPT 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 103/383 (27%)
SERPINA10XP_016876842.1 PZI 114..478 CDD:239010 103/383 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.