DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and serpinb1l1

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:400 Identity:118/400 - (29%)
Similarity:195/400 - (48%) Gaps:46/400 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELA---NTQTDIRS 131
            |.::..||.:|.|.: ....|..||..||.|:...||:::..|...|..|:...   |:|.. :.
Zfish     5 SAANTQFSLNLFKKI-SGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAH-QP 67

  Fly   132 QNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTN-PE 195
            ...:...::|.::...|....: .||:..:|:.:...:..:||....|.:||:.:|.:||.| .|
Zfish    68 VEQIHSNFKKFMSELNKPEAPY-VLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSE 131

  Fly   196 AAADAINAWAANITQGRLQQLVAPDNVRSSV-MLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDD 257
            .|...||.|....||.:::.|:....:.:.. ::|.|.|||.|.|..:|  ..|..|.|..:|:.
Zfish   132 DARVNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQ 196

  Fly   258 QSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYAL----NGIHDLVKNLENDELK 317
            ....:.|.|...|.....|::|:.:|.|||.||| |:.::||..:    .|:..|.:.|..::| 
Zfish   197 TKPVKMMHQKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKL- 260

  Fly   318 SAQWAMEEV----KVKVTLPKFHFDYQQNLKETLRSLGVREIFE-DSASLPGLTRGADVAGKVKV 377
             .:|...||    :|:|:||||..:...::|..|.|:|:.::|: ...:|.|::...|:.    :
Zfish   261 -MEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLV----L 320

  Fly   378 SNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEE---------FNVNRPFVFFIEEESTGN 433
            |..:.||.:.|||:||||.|||           .|||:         ||.:.||:|||....|.:
Zfish   321 SKAIHKAFVEVNEEGTEAAAAT-----------AAIEKLMCYIPPLSFNADHPFLFFIRHNPTKS 374

  Fly   434 ILFAGKVHSP 443
            |||.|::.||
Zfish   375 ILFYGRLCSP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 115/393 (29%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 116/398 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.