DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Acp76A

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:402 Identity:75/402 - (18%)
Similarity:166/402 - (41%) Gaps:68/402 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALL--AEAAGAGTQTQVELANTQ 126
            |.:.|::......|:.|::.:  :....:|.::|..:::::|..:  |:|..:....:..|....
  Fly    13 TSLLFQNTIQQNVSFQLIREI--DRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINF 75

  Fly   127 TDIRSQNNVREF---YRKTLNS-FKKENQLHET----LSVRTKLFTDSFIETQQKFTATLKHFYD 183
            ....::..|.::   |:|..:: |:..|::..:    ||.:.:|..:..:.:.:|:         
  Fly    76 GYSEARQEVLDWGLRYKKASSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTSAKKY--------- 131

  Fly   184 SEVEALDFTNPEAAADAINAWAANITQGRLQQLVAPDNVRSSVMLLTNLIYFNG-----LWRRQF 243
                  |.|.....:..::.|.::...|.|...|....:.:.    .|::..:|     ||...|
  Fly   132 ------DVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAG----ENIVAISGMTVTPLWASHF 186

  Fly   244 ATTFQ-------GSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYA 300
            .:...       |:.:.|| |.:....|.....|...::::.|.  :.:|:...| .:.:|||..
  Fly   187 QSEINRYFVNNPGTGYASK-DPTCVPMMHSLSSFETMSTDEAKG--IYIPFSSANLGMLILLPRK 248

  Fly   301 LNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGL 365
            .....|::.|| |:::.......::|.:.:.:.|..|||  |:.:....:.:.:.|:|||     
  Fly   249 GVTCKDILDNL-NNQINVEYNDHKDVHLLLPIFKEKFDY--NIAKFFNGINIEDTFKDSA----- 305

  Fly   366 TRGADVAGKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEES 430
               .....|:|::|.....||....      ...:..:::...|.|  |.|.|||||||.|:::.
  Fly   306 ---FKSKAKIKINNFRVNHGIRFQP------ILRLEVVDDIDTGKT--ETFEVNRPFVFVIKDKI 359

  Fly   431 TGNILFAGKVHS 442
              |:...|::.:
  Fly   360 --NVYAVGRIEN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 73/390 (19%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 73/389 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.