DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Spn47C

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster


Alignment Length:403 Identity:110/403 - (27%)
Similarity:182/403 - (45%) Gaps:49/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTD 128
            |..|..|.|...|:.:|.: .|.:|....|:::||...:..:.|:  ..|||.::..||.:..  
  Fly     6 TTAPSLSASPIVFARNLFR-ALNDEVPPVNMMVSPAGARSAMTLV--FMGAGGKSADELRSKL-- 65

  Fly   129 IRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQK----FTATLKHFYDSEVEAL 189
            |...:|..|..::...|:..|....:. .|..:|.|..::..::|    |......|:::|..:|
  Fly    66 ILGVSNKSEVAKQHAESWTDECSCAKK-GVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSL 129

  Fly   190 DFTNPEAAADAINAWAANITQGRLQQLVAPD--NVRSSVMLLTNLIYFNGLWRRQF--ATTFQGS 250
            ::.|||.:...:|.|....|...::.|..|:  |..||| :|.|.::|...|.:.|  ..|....
  Fly   130 NYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSV-ILVNSLFFRAKWNKIFPQQLTQIDD 193

  Fly   251 FFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLEND 314
            |:.:...:.....|.|...|.|..|:|||:|||:||::..| ::.::||.|::|:.:|       
  Fly   194 FWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPEL------- 251

  Fly   315 ELKSAQWAMEEV-------KVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVA 372
            |.|..|..|.||       :|.||:|||..:...:||..|:.:|:..:|:  |....|:...::.
  Fly   252 EEKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFD--AGQADLSDLFEMK 314

  Fly   373 GKVKVSNILQKAGINVNEKGTEAYAATVVEIE-------NKFGGSTAIEEFNVNRPFVFFIEEES 430
            ...|:|....|..:||.|.|.|......|:.|       .||        |..:|||||.|.:..
  Fly   315 TPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKF--------FKADRPFVFAIRDRK 371

  Fly   431 TGNILFAGKVHSP 443
              |:.|.|....|
  Fly   372 --NVYFVGHFVKP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 106/390 (27%)
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 105/386 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.