DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Spn31A

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster


Alignment Length:410 Identity:104/410 - (25%)
Similarity:173/410 - (42%) Gaps:87/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GAGIYDDIDTFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGT--- 116
            |||||..|.|                       ..|::||::||..::..|:||...:...|   
  Fly    15 GAGIYHSIAT-----------------------SFAEQNVVVSPLLLEATLSLLFLGSDGATAEE 56

  Fly   117 -QTQVELANTQTDIRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFI-ETQQKFTATLK 179
             |.|:.|   :....|...:..||...|.:...:......|..|..|.::|.: :..||...|  
  Fly    57 LQKQLRL---KQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQT-- 116

  Fly   180 HFYDSEVEALDFTNPEAAADAINAW-AANITQGRLQQL-VAPDNVRSSVMLL--TNL-------- 232
             ::.:..|.:|....|.....|:.. .|::..|..:.: ||..:..::::||  .||        
  Fly   117 -YFHATAECVDLEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPF 180

  Fly   233 -IYFNGLWRRQFATTFQGSFFRSK----DDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN- 291
             .|..||:  :|   ..||..:|.    ||....:|.|..|         |.|:.:.|||:... 
  Fly   181 SAYRTGLY--EF---HSGSQVKSVPMLFDDDMFVKFAELRD---------LDARAIELPYEHAEE 231

  Fly   292 -SLFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREI 355
             |:.::||....|:.:|.|.|.:.:|.:.|..|:...|:|.||||..|::.:|::.|:.||..||
  Fly   232 LSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEI 296

  Fly   356 FEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEA----------YAATVVEIENKFGGS 410
            |..||:...|...|:    :.::::|||..||:||.|:.:          |...|:      ..|
  Fly   297 FAASANFKHLHASAN----LPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVI------SNS 351

  Fly   411 TAIEEFNVNRPFVFFIEEES 430
            :..:.|..:.||.|.|..|:
  Fly   352 SRQKFFRADHPFFFAIRSEN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 97/393 (25%)
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 101/407 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.