DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Spn28B

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:376 Identity:97/376 - (25%)
Similarity:178/376 - (47%) Gaps:27/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYRKT 142
            |.....:|.::.|.:|:|.||.|.:::::::..|:|.  :|..||.|......::..|...||..
  Fly    18 WEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGG--KTFEELRNVLKFSENKTLVANNYRSL 80

  Fly   143 LNSFKKENQLHET---LSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAW 204
            |:..|:    .||   |.:..:::.:.......:|....:..:.::.:::...:|.:|:..:|:|
  Fly    81 LSDLKR----RETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSW 141

  Fly   205 AANITQGRLQQLVAPDNVRSSV-MLLTNLIYFNGLWRRQFAT--TFQGSFFRSKDDQSRAEFMEQ 266
            ..|.|:|.::.:|.|.:..|.. ..|.|.|||.|.|...|..  |....|:.|.::....:.|..
  Fly   142 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTL 206

  Fly   267 TDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKV 330
            :........:.:.|:|:.|||.... |:.::||.:::|:..|     .:::....:.:|:..|.|
  Fly   207 SASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKL-----KEKVGFIDYHLEKKSVNV 266

  Fly   331 TLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEA 395
            .||||..:.:..||....:||:.::|:.||.|.||.    :....|:..|:|||.:.::|||.||
  Fly   267 KLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLV----LESGAKIDKIVQKAFLKIDEKGGEA 327

  Fly   396 YAATVVEIENKFGGSTAIE---EFNVNRPFVFFIEEESTGNILFAGKVHSP 443
            .|||.|....|......|:   ||..:.||.:.|.:...  |.|.|.:..|
  Fly   328 SAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 96/371 (26%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 96/371 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.