DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and RGD1562844

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:283 Identity:89/283 - (31%)
Similarity:142/283 - (50%) Gaps:28/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FKKENQLHETLSVR--TKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADA---INAWA 205
            |||.|:.....|:|  ..:|.|...|....|..:...||:||:|.|.|.  |||.::   :|.|.
  Rat    24 FKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFA--EAAEESRKHVNTWV 86

  Fly   206 ANITQGRLQQLVAPDNVR-SSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQSRAEFMEQT 267
            :..|:|::.:|:..|:|. .:.::|.|.:|....|.|||  .:|.:..|..:|::....:.|.|.
  Rat    87 SKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNETRPVQMMYQE 151

  Fly   268 DYFYYTTSEKLKAQILRLPYKGKNSLF-VLLPYALNGIHDLVKNLENDELKSAQW----AMEEVK 327
            ..|.|...:::.|.:|.:||||....| ||||.....|..:.:.|..::|.:  |    .|....
  Rat   152 GIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEELTFEKLTA--WTQPDTMSYTH 214

  Fly   328 VKVTLPKFHFDYQQNLKETLRSLGVREIFEDS-ASLPGLTRGADVAGKVKVSNILQKAGINVNEK 391
            |:|.||||..:...:||..|:.||:.:.||:: |.|..:....::.    ||..:.|:.:.||||
  Rat   215 VEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAMAPERNLC----VSKFVHKSVVEVNEK 275

  Fly   392 GTEAYAA----TVVEIENKFGGS 410
            ||||.||    .:|.:.:  |||
  Rat   276 GTEAAAAASSVNIVPLSS--GGS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 89/283 (31%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.