DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:394 Identity:120/394 - (30%)
Similarity:202/394 - (51%) Gaps:38/394 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALL-AEAAGAGTQTQVELANT-----QTD 128
            |.::..|:..|..|:  :|::....|.||||:...||:: ..|.|:...:.:.||.|     ..|
  Rat     5 SSANSLFALELFHTL--SESSPTGNIFSPFSISSALAMVFLGAKGSSAPSSLRLAETFHFDSVED 67

  Fly   129 IRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTN 193
            |.|:       .::||:..:::....||.|..:|:.:.......:|.|:.:..|.:::..:||.:
  Rat    68 IHSR-------FQSLNAEMRKHGASHTLKVANRLYGEKTYNFLPEFLASTQKMYGADLAPVDFQH 125

  Fly   194 -PEAAADAINAWAANITQGRLQQLVAPDNVRSSV-MLLTNLIYFNGLWRRQFAT--TFQGSFFRS 254
             .|.|...||.|....|:|::.:|:|...|.|:. ::|.|.|||.|:|:.:|.|  |....|..:
  Rat   126 ASEDARKEINKWVKGQTEGKIPELLAGGVVNSTTKLVLVNAIYFKGIWQEKFLTRHTTDAPFRLN 190

  Fly   255 KDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYK-GKNSLFVLLPYAL----NGIHDLVKNLEND 314
            |.|....:.|.|.:.|.:.....||.::|.:||: |:.|:.:|||..:    .|:..:.:.|..:
  Rat   191 KKDTKMVKMMYQKEKFPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLQKIEEQLTLE 255

  Fly   315 ELKSAQWA----MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDS-ASLPGLTRGADVAGK 374
            :|  .:|.    ::|:.|.|.||||..:....|...|..||::::|..| |.|.|::...|:.  
  Rat   256 KL--YEWTKHENLKEIDVHVNLPKFKIEESYILNSNLGRLGLQDLFSSSKADLSGMSESRDIF-- 316

  Fly   375 VKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGK 439
              :|.|:.|:.:.|||:||||.|||...:|...   .:||.|.|:.||:|||....|.|:||.|:
  Rat   317 --ISKIVHKSFVEVNEEGTEAAAATAGLVEYCL---VSIEAFIVDHPFLFFIRHNPTANMLFFGR 376

  Fly   440 VHSP 443
            |.||
  Rat   377 VCSP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 116/387 (30%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 118/392 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.