DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpinb3

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001382662.1 Gene:Serpinb3 / 304688 RGDID:1549766 Length:387 Species:Rattus norvegicus


Alignment Length:390 Identity:120/390 - (30%)
Similarity:198/390 - (50%) Gaps:42/390 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELA-----------NTQTDIRSQNN 134
            |:...|...::.|:..||.|:...||:|...|...|:.|:|.|           ....|...:.|
  Rat    13 LELYRQLRDSEDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKALQLSETTKKPKEKSADSHDEEN 77

  Fly   135 VREFYRKTLNSFKKENQLHETLSVRT----KLFTDSFIETQQKFTATLKHFYDSEVEALDFTN-P 194
            |.|.:||.:|...|.|..::..|..:    |.|  .|::|   |...:|.:|.:.||:|||.: .
  Rat    78 VHEQFRKIMNQLNKSNGAYDLKSPNSIYGAKGF--PFLQT---FMEDIKKYYQANVESLDFAHAA 137

  Fly   195 EAAADAINAWAANITQGRLQQLVAPDNVRSS-VMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKD 256
            |.:...||:|..|.|.|:::.|....::.|| :::|.|.:||.|.|..:|  ..|.:..|:.:|:
  Rat   138 EESQKKINSWVENKTNGKIKDLFPRGSLNSSTILVLVNAVYFKGQWNHKFDEQRTREDKFWLNKN 202

  Fly   257 DQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQ 320
            .....:.|.||:.|.:...|.::|:::.:|||||. |:|:|||..::|:..|.:.|..|.|.:  
  Rat   203 TSKPVQMMRQTNEFNFIFLEDVQAKMVEIPYKGKELSMFILLPMEIDGLKKLEEKLSADTLLA-- 265

  Fly   321 WA----MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFE-DSASLPGL--TRGADVAGKVKVS 378
            |.    |...::.::||:|....:.:|...|..:|:.:.|. ..|...|:  |:|      :.||
  Rat   266 WTSPKNMRMTQLNLSLPRFKVQEKYDLPGPLEHMGMVDAFNPQKADFSGMSSTKG------LVVS 324

  Fly   379 NILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSP 443
            .:|.|:.:.|||:|.||.|||  .:|.:...:....||..||||:.||:..:|.:|||.|:|.||
  Rat   325 KVLHKSFLEVNEEGAEAAAAT--GVETRILSAPRTTEFTCNRPFIVFIKPNNTNSILFFGRVSSP 387

  Fly   444  443
              Rat   388  387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 117/385 (30%)
Serpinb3NP_001382662.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.