DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:391 Identity:101/391 - (25%)
Similarity:181/391 - (46%) Gaps:36/391 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVE--LANTQTDIRSQN 133
            :::..|:..:|:.:  .|.:.|||..||.|:...|:::...|...|.:|:.  |:....:.....
  Rat     6 EANATFALKVLRVL--GEDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGG 68

  Fly   134 NVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTN-PEAA 197
            :..:.::..|....|.::.| .|.....:|.:...|....|..:.:.||::|:|.:||.. ||.:
  Rat    69 DFHQCFQSLLTEVNKSDRRH-MLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQS 132

  Fly   198 ADAINAWAANITQGRLQQLVAPDNVRSSVML-LTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQS 259
            ...||.|.|..|:..:::|::|..|.|:..| |.|..||.|.|.:.|  ..|.:..|..||:::.
  Rat   133 RQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKK 197

  Fly   260 RAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQWA- 322
            ..:.|.....|.....|.:...:..|||.|.. |:.::||.....:..:...:..::|  .:|. 
  Rat   198 IVQMMFNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKL--IEWTR 260

  Fly   323 ---MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDS-------ASLPGLTRGADVAGKVKV 377
               |:|.:|::.||:|..:...::|..|..||:...|||.       :|.|||.          :
  Rat   261 LENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGISSKPGLF----------L 315

  Fly   378 SNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHS 442
            |.::.|:.:.|||:||||.|.|.:.   ..|...:.:....:.||:|.|:::....|||.|:..|
  Rat   316 SKVVHKSVVEVNEEGTEAAAPTEIV---TMGSPLSPQCLVADHPFLFLIQDDRNKAILFLGRFSS 377

  Fly   443 P 443
            |
  Rat   378 P 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 99/385 (26%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.