DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and AT2G35555

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001323897.1 Gene:AT2G35555 / 28718328 AraportID:AT2G35555 Length:122 Species:Arabidopsis thaliana


Alignment Length:102 Identity:31/102 - (30%)
Similarity:46/102 - (45%) Gaps:37/102 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 LNGIHDLVKNLENDELKSAQWA-MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPG 364
            |||..|:          .:.|| :.|:|:    |:|.||:.               ||.|.:|.|
plant    12 LNGKEDI----------PSHWADVGELKI----PRFKFDFG---------------FEASEALKG 47

  Fly   365 LTRGADVAGKVKVSNILQKAGINVNEKGTEAYAATVV 401
            |  |.:|.     |.|:.|:.|.|:|.|::|.||.|:
plant    48 L--GLEVP-----STIIHKSCIEVDEVGSKAAAAAVI 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 31/102 (30%)
AT2G35555NP_001323897.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.