DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpina3b

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:361 Identity:92/361 - (25%)
Similarity:166/361 - (45%) Gaps:25/361 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SVPSGAGIYDDIDTFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAG 115
            :|..|......:|:......::...||:: .:..|:|  ..||:..|||.:...|..|...|...
Mouse    31 AVQKGQDTQKQLDSLTLASINTDFAFSFY-KELALKN--PHKNIAFSPFGIATALNSLTLGAKGN 92

  Fly   116 TQTQV-ELANTQTDIRSQNNVREFYRKTLNSFKKENQLHETLSVRT--KLFTDSFIETQQKFTAT 177
            |..:: |:........|:.::.:.::..|.......   :.:.:||  .||.:..::...:|...
Mouse    93 TLEEILEVLKFNLTETSEADIHQGFKHLLQRLSHPG---DQVQIRTGNALFVEKHLQILAEFKEK 154

  Fly   178 LKHFYDSEVEALDFTNPEAAADAINAWAANITQGRLQQLVAPDNVRSSVMLLTNLIYFNGLWRRQ 242
            .:..|.:||...:|..|..|...||::.:|.|||::::||: |...::.|::.|.::|...|...
Mouse   155 ARALYHTEVFTANFQQPHEAMKLINSYMSNQTQGKIKELVS-DMDGNTSMVIVNDLFFKAEWMVP 218

  Fly   243 FAT--TFQGSFFRSKDDQSRAEFME----QTDYFYYTTSEKLKAQILRLPYKGKNSLFVLLPYAL 301
            |.:  ||.|.|...:....:...|:    :|.||   ..|:||..::.|.|||......:|| ..
Mouse   219 FNSDDTFMGKFIVDRSRHVKVPMMKTKNLRTPYF---RDEELKCTVVELNYKGNGKAMFILP-DQ 279

  Fly   302 NGIHDLVKNLENDELKSAQWAMEEVKVK-VTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGL 365
            ..:..:..:|:...||..:.::...|:| :.||||......||::.|..||:||:|...|.|.|:
Mouse   280 GKMQQVEASLQPGTLKKWRKSLRPRKIKELHLPKFSLSQHYNLEDILPELGIRELFSTQADLSGI 344

  Fly   366 TRGADVAGKVKVSNILQKAGINVNEKGTEAYAATVV 401
            |.    ...:.||.::....:::.|||||..|.|:|
Mouse   345 TG----VKNITVSEMIHSTELDMTEKGTEGDAITIV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 89/340 (26%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 89/341 (26%)
RCL 367..392 6/10 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.