DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpina4

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_659565.2 Gene:Serpina4 / 246328 RGDID:708581 Length:423 Species:Rattus norvegicus


Alignment Length:389 Identity:106/389 - (27%)
Similarity:187/389 - (48%) Gaps:48/389 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQV--ELANTQTDIRSQNNVREFYR 140
            :||    :.::.::||:..||.|:.:.||:|:..||..||.|:  .|....|.: |...:.|.:|
  Rat    60 YHL----IASQNSEKNIFFSPLSISVSLAILSTGAGGDTQAQILEGLGFNLTKL-SLPEIHEGFR 119

  Fly   141 KTLNSFKK---ENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAIN 202
            ...::..:   |.|    :||.:.|.....::...:|.:.::..|:|:|...:|.:.|||...||
  Rat   120 SLQHTIARPFTEPQ----ISVGSALILSQNLQILSEFVSAIETSYNSKVLHANFRDKEAAVQLIN 180

  Fly   203 AWAANITQGRLQQLV---APDNVRSSVMLLTNLIYFNGLWRRQFATT--FQGSFFRSKDDQSRAE 262
            .:....|||:::.||   :|| |:   |:|.|.|:|.|||::.|.::  ....|:..::...:..
  Rat   181 NYVKQNTQGKIKNLVSDLSPD-VK---MVLVNYIFFQGLWKKPFPSSRVSTSDFYVDENTVVKIP 241

  Fly   263 FM--EQTDYFYYTTSEKLKAQILRLPYKGKNSLFVLLPYALNGIHDLVKNLENDELKS----AQW 321
            .|  ::.|: :|....::...:||:.|:|....|.:||       |..|..|.:::.|    .:|
  Rat   242 MMLQDKEDH-WYLEDRRVPCTVLRMDYRGDAVAFFILP-------DQGKMNEVEQVLSPGMLLRW 298

  Fly   322 ------AMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNI 380
                  .....|:.:.||||.......|.|.|..||.:::|..:|:...:::    ..|:.:|.:
  Rat   299 KRLLQNRFFYRKLILQLPKFSISNSYELDEILPDLGFQDLFTPNANFSNISK----KEKLYLSKV 359

  Fly   381 LQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSPT 444
            ..|..::|||.||:|.||| ......|...........||||:..:...|:.:|||.|||.:||
  Rat   360 FHKTVLDVNEVGTKAAAAT-GSFATFFSAQPKKRYLIFNRPFLVILYSTSSQDILFMGKVVNPT 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 102/383 (27%)
Serpina4NP_659565.2 SERPIN 52..418 CDD:294093 102/383 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.