DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpinb13

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:393 Identity:100/393 - (25%)
Similarity:189/393 - (48%) Gaps:39/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVE-------------LANTQT 127
            |.:.|.|.:  |:|.|.||..||..:...:.::.......|.::::             :.:.:.
Mouse    11 FLFDLFKEL--NKTNDGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIKSEEE 73

  Fly   128 DIRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFT 192
            :|..:..:....:..|....|.:..:: |.:..:||.:......||:...::.:|.:.:|.:||.
Mouse    74 EIEKREEIHHQLQMLLTEISKFSNDYD-LIISNRLFGEKTYLFLQKYIDYVEKYYHASLEPVDFV 137

  Fly   193 NPEAAAD----AINAWAANITQGRLQQLVAPDNVRSSV-MLLTNLIYFNGLWRRQFAT--TFQGS 250
            |   |||    .||:|..:.|..:::.|....::.||. ::|.|.:||.|||.|:|..  |.:..
Mouse   138 N---AADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEED 199

  Fly   251 FFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLEND 314
            |:.:|:.....:.|.....|.:|..|.|:|:|:.:|||..: |:|||||..::|:..::..:..:
Mouse   200 FWLNKNLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPE 264

  Fly   315 ELKSAQWA----MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKV 375
            :|  .:|.    :|:.:|.:.||:...:...:|:..|.::|:...|.:.|...|::    ....:
Mouse   265 KL--VEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMS----ARSGL 323

  Fly   376 KVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKV 440
            ...|.|.::.:.|.|:|.||.|.|.|.:  |...:.:.|..:.|.||:|||....:.:|||.||.
Mouse   324 HAQNFLHRSFLVVTEEGVEATAGTGVGL--KVSSAASCELVHCNHPFLFFIRHRESDSILFFGKF 386

  Fly   441 HSP 443
            .||
Mouse   387 SSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 97/388 (25%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 98/391 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.