DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpinb9f

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_899020.1 Gene:Serpinb9f / 20709 MGIID:894671 Length:377 Species:Mus musculus


Alignment Length:384 Identity:116/384 - (30%)
Similarity:191/384 - (49%) Gaps:21/384 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNN 134
            |.::..|:.|||| ||..:...|||..||.|:...||::...|...|..|:..|   ..:....:
Mouse     5 SQANGTFAIHLLK-VLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQA---LHLNPDED 65

  Fly   135 VREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTN-PEAAA 198
            |.:.::..|::..|:|.....|.:..:||.::..|....|..:...||.||:|.|.|.. .|.:.
Mouse    66 VHQGFQLLLHNLNKQNNQKYCLRMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAKAAEESR 130

  Fly   199 DAINAWAANITQGRLQQLVAPDNVRSSV-MLLTNLIYFNGLWRRQFA--TTFQGSFFRSKDDQSR 260
            ..||.|.:..|.|::..|::.|:|.|.. ::|.|.:||:|.|.::|.  .|.:..|..:|.:...
Mouse   131 QHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRP 195

  Fly   261 AEFMEQTDYFYYTTSEKLKAQILRLPYKGKNSLF-VLLPYALNGIHDLVKNLENDELKSAQWA-- 322
            .:.|.:.|..::...::::||:|.:||:|.:..| ||||.....|..:..||..::|.:  |.  
Mouse   196 VQMMWREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTA--WTKP 258

  Fly   323 --MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDS-ASLPGLTRGADVAGKVKVSNILQKA 384
              |...:..|.||||......::...|:.||:..:|:.| |.|.|::...::.    :|..:.|.
Mouse   259 EFMNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLC----LSEFVHKC 319

  Fly   385 GINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSP 443
            .:.|||:||||.||:.||......|... |.|..:.||:|||...:|.:|||.|:..||
Mouse   320 VVEVNEEGTEAAAASAVEFIFLCLGPDP-ETFCADHPFLFFIMHSTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 113/377 (30%)
Serpinb9fNP_899020.1 SERPIN 4..377 CDD:294093 114/382 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.