DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpina1c

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_033271.1 Gene:Serpina1c / 20702 MGIID:891969 Length:413 Species:Mus musculus


Alignment Length:375 Identity:99/375 - (26%)
Similarity:168/375 - (44%) Gaps:37/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQV----ELANTQTDIRSQNNVREFYR---KT 142
            |.:::...|:..||.|:....|:|:..:...|.||:    :...|||   |:.::.:.::   :|
Mouse    59 LVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQT---SEADIHKSFQHLLQT 120

  Fly   143 LNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAWAAN 207
            ||....|.|    ||....||.::.::..:||....|:.|.:||.:::|...|.|...||.:...
Mouse   121 LNRPDSELQ----LSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEK 181

  Fly   208 ITQGRLQQLVAPDNVRSSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQSRAEFMEQTDYF 270
            .|||::.:.|...: :.:|..|.|.|.|.|.|::.|  ..|.:..|...:....:...|..:...
Mouse   182 GTQGKIAEAVKKLD-QDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGML 245

  Fly   271 YYTTSEKLKAQILRLPYKGKNSLFVLLPYALNG-IHDLVKNLENDELKSAQWAMEEVKVKVTLPK 334
            .......|.:.:|.:.|.|..:...|||.  :| :..|.:.|..:.:............::..|:
Mouse   246 DVHHCSTLSSWVLLMDYAGNATAVFLLPD--DGKMQHLEQTLSKELISKFLLKRPRRLAQIHFPR 308

  Fly   335 FHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEAYAAT 399
            .....:.|||..:..||:..||.:.|.|.|:|   :....:|:|..:.||.:.::|.||||.|||
Mouse   309 LSISGEYNLKTLMSPLGITRIFNNGADLSGIT---EENAPLKLSQAVHKAVLTMDETGTEAAAAT 370

  Fly   400 VVEIENKFGGSTAIEE-----FNVNRPFVFFIEEESTGNILFAGKVHSPT 444
            |:         .|:..     ...:.||:|.|.||.|.:.||.|||..||
Mouse   371 VL---------LAVPYSMPPIVRFDHPFLFIIFEEHTQSPLFVGKVVDPT 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 95/369 (26%)
Serpina1cNP_033271.1 SERPIN 53..410 CDD:214513 97/372 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.