DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and Serpina1a

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus


Alignment Length:457 Identity:121/457 - (26%)
Similarity:198/457 - (43%) Gaps:60/457 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSALATGNGNSIPTTTTPQ---GVFETRTDKLPGGAASVPSGAGIYDDI---DTFVPFRSDSHDP 75
            ||.|.|..|.......||.   |:.     .|.|....|||  .:.:|:   ||....:|.:...
Mouse     9 LSRLFTVKGQKARWKMTPSISWGLL-----LLAGLCCLVPS--FLAEDVQETDTSQKDQSPASHE 66

  Fly    76 FSWHL------LKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQV----ELANTQTDIR 130
            .:.:|      |...|.:::...|:..||.|:....|:|:..:...|.||:    :...|||   
Mouse    67 IATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQT--- 128

  Fly   131 SQNNVREFYR---KTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFT 192
            |:.::.:.::   :|||....|.|    ||....||.::.::..:||....|:.|.:||.:::|.
Mouse   129 SEADIHKSFQHLLQTLNRPDSELQ----LSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFA 189

  Fly   193 NPEAAADAINAWAANITQGRLQQLVAPDNVRSSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSK 255
            ..|.|...||.:....|||::.:.|...: :.:|..|.|.|.|.|.|::.|  ..|.:..|...:
Mouse   190 ESEEAKKVINDFVEKGTQGKIAEAVKKLD-QDTVFALANYILFKGKWKKPFDPENTEEAEFHVDE 253

  Fly   256 DDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKNSLFVLLPYALNGIH-------DLV-KNLE 312
            ....:...|..:...:......|.:.:|.:.|.|..:...|||......|       :|: |.|.
Mouse   254 STTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLL 318

  Fly   313 NDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKV 377
            |...:.||         :..|:.....:.|||..:..||:..||.:.|.|.|:|   :....:|:
Mouse   319 NRRRRLAQ---------IHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGIT---EENAPLKL 371

  Fly   378 SNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHS 442
            |..:.||.:.::|.||||.|.||:::...  ....|..|  :.||:|.|.||.|.:.:|.|||..
Mouse   372 SQAVHKAVLTIDETGTEAAAVTVLQMVPM--SMPPILRF--DHPFLFIIFEEHTQSPIFLGKVVD 432

  Fly   443 PT 444
            ||
Mouse   433 PT 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 100/390 (26%)
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 101/380 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.