DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn27A and AgaP_AGAP012938

DIOPT Version :9

Sequence 1:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_306495.4 Gene:AgaP_AGAP012938 / 1267938 VectorBaseID:AGAP012938 Length:294 Species:Anopheles gambiae


Alignment Length:294 Identity:86/294 - (29%)
Similarity:127/294 - (43%) Gaps:50/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LLAEAAGAGTQTQVELANTQTDIR---SQNNVREFY---RKTLNS-FKKENQLHETLSVRTKLFT 164
            ||....||...|: :|..|..:::   |:..|.|.|   ||:|.. |.:.|.:  ..|...|||.
Mosquito     4 LLMMYFGARDTTE-KLLRTSLNLQWADSKTTVYEAYDTARKSLRGRFSESNAV--GFSSADKLFF 65

  Fly   165 DSFIE----TQQKFTATLKHFYDSEVEALDF-TNPEAAADAINAWAANITQGRLQQLVAPDNV-R 223
            ...|.    .||||..|        :|.||: |.|:.....||.|..|.|:|:::.|:.|..: |
Mosquito    66 GRQIPVSTCVQQKFADT--------IELLDYQTQPDEQRAYINRWVENATRGQIKDLLEPGAITR 122

  Fly   224 SSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLP 286
            ::.:.:.|..||.|.|:.:|  |.|.:..|:.|.|.|...:.|.....|.:..:|||...||.||
Mosquito   123 NTKLAVANAAYFKGTWQTKFKAAETNKEIFYVSADQQKFVDMMHVEGTFSHAANEKLGCHILELP 187

  Fly   287 YK---------------------GKNSLFVLLPYA-LNGIHDLVKNL--ENDELKSAQWAMEEVK 327
            |.                     .:.|:||.||.| .|.:..|:..|  |.|.|..........|
Mosquito   188 YSAGPGADNADDGPYQQGAANPDNQVSMFVFLPPAEPNALSKLLSRLAAETDILHEVVNEGISRK 252

  Fly   328 VKVTLPKFHFDYQQNLKETLRSLGVREIFEDSAS 361
            |.|.||||..:....:|..|..:|:.::|:..|:
Mosquito   253 VDVKLPKFSIEKTVGMKPVLERMGLGQLFDQGAN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 86/294 (29%)
AgaP_AGAP012938XP_306495.4 SERPIN 1..>287 CDD:238101 86/294 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.