DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlnRS and MSE1

DIOPT Version :9

Sequence 1:NP_524841.1 Gene:GlnRS / 45786 FlyBaseID:FBgn0027090 Length:778 Species:Drosophila melanogaster
Sequence 2:NP_014609.1 Gene:MSE1 / 854124 SGDID:S000005393 Length:536 Species:Saccharomyces cerevisiae


Alignment Length:314 Identity:76/314 - (24%)
Similarity:124/314 - (39%) Gaps:73/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 VHTRFPPEPNGILHIGHAKAININFGYAAAHDGVCYLRYDDTNPEKEEEKFFLAIKEMVEWLGYK 331
            |.|||.|.|.|.||:|..:....|:..|...:|...||.:||:.::..|.....|.|:::|.   
Yeast    45 VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILKWC--- 106

  Fly   332 PFKITYSSDNFQQ-----LYE-WAVVLINKGLAYVC----------------------------- 361
              .|.|.....:|     :|: :..:|::.|.||.|                             
Yeast   107 --NINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMASYDRCC 169

  Fly   362 -HQKAEELKGFNPKPSPWRER-PIEESLRLFEDMKRGKIDEGAATLRMKVTLEEGKMDPVAYRIK 424
             |...||:|....:..|:..| ...|....|.|:..|:|:     |:.:|...:.:.|.:.. :|
Yeast   170 AHLGEEEIKSKLAQGIPFTVRFKSPERYPTFTDLLHGQIN-----LQPQVNFNDKRYDDLIL-VK 228

  Fly   425 FISHHRTGSDWCIYPTYDYTHCLCDSLEDITHSLCTKEFQSRRSSYYWLCNALGIYCPVQWEYGR 489
                    ||  ..|||...:.:.|.|..|||.:..:|:......:..|.||.|..||   ::..
Yeast   229 --------SD--KLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFGWACP---KFIH 280

  Fly   490 LNMNYALVSKRKIAKLITEQIVHDWDDPRLFTLTALRRRGFPAEAINNFCAQMG 543
            :.: ...|..:|::|...:..:.|           |:|:|...||:.||||..|
Yeast   281 IPL-LTTVGDKKLSKRKGDMSISD-----------LKRQGVLPEALINFCALFG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlnRSNP_524841.1 PLN02859 10..777 CDD:178450 76/314 (24%)
MSE1NP_014609.1 gltX_bact 44..533 CDD:273092 76/314 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.