DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlnRS and Ears2

DIOPT Version :9

Sequence 1:NP_524841.1 Gene:GlnRS / 45786 FlyBaseID:FBgn0027090 Length:778 Species:Drosophila melanogaster
Sequence 2:NP_001152965.1 Gene:Ears2 / 361641 RGDID:1307904 Length:523 Species:Rattus norvegicus


Alignment Length:383 Identity:94/383 - (24%)
Similarity:141/383 - (36%) Gaps:110/383 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GGKVHTRFPPEPNGILHIGHAKAININFGYAAAHDGVCYLRYDDTNPEKEEEKFFLAIKEMVEWL 328
            |..|..||.|.|.|.||:|..:....|:.:|..|.|...||.:||:..:........|::|:||.
  Rat    34 GVTVRVRFAPSPTGFLHLGGLRTALYNYIFAKKHQGSFILRLEDTDQSRLVPGAAENIEDMLEWA 98

  Fly   329 GYKPFKIT---------YSSDNFQQLYEWAVVLINKGLAYVCH---QKAEELK------------ 369
            |..|.:..         |.|.......:....|:..|.||.|.   |:.|.||            
  Rat    99 GIPPDESPRQGGPAGPYYQSQRLALYAQATEALLKSGAAYPCFCSPQRLELLKKEALRSRQTPRY 163

  Fly   370 ----------------GFNPKPSPWRERPIEESLRLFEDMKRGKIDEGAATLRMKVTLEEGKMDP 418
                            ..:|||: .|.| :||::..|:|:..|......|::       ||  ||
  Rat   164 DNRCRNLSQAQVAQKLATDPKPA-IRFR-LEEAVPAFQDLVYGWTQHEVASV-------EG--DP 217

  Fly   419 VAYRIKFISHHRTGSDWCIYPTYDYTHCLC---DSLEDITHSLCTKEFQSRRSSYYWLCNALGIY 480
            |..:          ||.  :|||   |..|   |....|:|.|...|:....|.:..|..||| :
  Rat   218 VILK----------SDG--FPTY---HLACVVDDHHMSISHVLRGSEWLVSTSKHLLLYQALG-W 266

  Fly   481 CPVQWEYGRLNMNYALVSKRKIAKLITEQ----IVHDWDDPRLFTLTALRRRGFPAEAINNFCAQ 541
            .|.|:.:..|.:|      |..:||...|    :.|       |..|     ||..||:.:....
  Rat   267 QPPQFAHLPLLLN------RDGSKLSKRQGDIFLEH-------FAAT-----GFLPEALLDIITN 313

  Fly   542 MGVTGAQIAVDPAMLEAAVRDVLNVTAPRRLVVLEPLKVTIKNFPHAAPVQLE-VPDF 598
            .|...|:             :.:..|.|..:...:..::|.    |:|.:.|| :|:|
  Rat   314 CGSGFAE-------------NQMGRTLPELITQFDLTRITC----HSALLDLEKLPEF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlnRSNP_524841.1 PLN02859 10..777 CDD:178450 94/383 (25%)
Ears2NP_001152965.1 gltX 36..521 CDD:234953 93/381 (24%)
GluRS_core 36..361 CDD:173905 93/381 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.