DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlnRS and AT1G68325

DIOPT Version :10

Sequence 1:NP_524841.1 Gene:GlnRS / 45786 FlyBaseID:FBgn0027090 Length:778 Species:Drosophila melanogaster
Sequence 2:NP_001321143.1 Gene:AT1G68325 / 28717408 AraportID:AT1G68325 Length:96 Species:Arabidopsis thaliana


Alignment Length:72 Identity:31/72 - (43%)
Similarity:43/72 - (59%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 DPNEVPGGFLSDISEQSMSVVV-AFADRALNQAKVYDKFQFERIGFFSVDPDTSANHLVFNRTVG 770
            :|.|:. .:|:||:..|..||. |||...|.:|.:.|||||||:       |::...|||||||.
plant    31 NPGELE-NWLNDINTNSRVVVSDAFAVPTLKEAALGDKFQFERL-------DSTPEKLVFNRTVT 87

  Fly   771 LKEDAGK 777
            :||.:.|
plant    88 MKESSSK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlnRSNP_524841.1 PLN02859 10..777 CDD:178450 30/70 (43%)
AT1G68325NP_001321143.1 PLN02859 <31..96 CDD:178450 31/72 (43%)

Return to query results.
Submit another query.