DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlnRS and pars-1

DIOPT Version :9

Sequence 1:NP_524841.1 Gene:GlnRS / 45786 FlyBaseID:FBgn0027090 Length:778 Species:Drosophila melanogaster
Sequence 2:NP_001370820.1 Gene:pars-1 / 176024 WormBaseID:WBGene00004189 Length:581 Species:Caenorhabditis elegans


Alignment Length:316 Identity:61/316 - (19%)
Similarity:104/316 - (32%) Gaps:102/316 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VRGELKWADAKSVKAAIDVEIFDLLGPK-TEADLKPQTKANDKPKAAKPKAEVTPAAQTAEAASD 219
            |:|: |.:..::.|.|||    .||..| |..::..|..|....:.:|||.|..|..|.      
 Worm    21 VKGD-KNSTEEAKKEAID----KLLALKLTYKEVTGQEYAAPNARQSKPKKEEKPKQQP------ 74

  Fly   220 GATTISELMKTKVHFHAPGENFKADGYVVTEHTERLLKEHLARTGGKVHTRFPPEPNGILHIGHA 284
                                                 |:...:..||..|        :|.:|..
 Worm    75 -------------------------------------KQQEKKQDGKKQT--------LLGVGTK 94

  Fly   285 KAININFGYAAAHDGVCYLRYDDTNPEKEEEKFFLAIKEMV-EWL--GYKPFKITYSSDNFQQLY 346
            |..|.:..|:........:.|.|.:.......:..|:.|.: ||.  |.|...:       :..|
 Worm    95 KDDNYSEWYSEVITKAEMIEYYDVSGCYVLRPWSFAVWESIQEWFDSGIKKLGV-------KNCY 152

  Fly   347 EWAVVLINKGLAYVCHQKAEELKGFNPKPSPWRERPIEESLRLFEDMKRGKIDEGAATLRMKVTL 411
             :.:.:.|..|    .::...:..|.|:.: |              :.|....|.|..:.::.| 
 Worm   153 -FPMFVSNAAL----EREKTHIADFAPEVA-W--------------VTRAGNSEMAEPIAIRPT- 196

  Fly   412 EEGKMDPVAYRIKFISHHR----TGSDWCIYPTYDYTHCLCDSLEDITHSLCTKEF 463
            .|..|.| :|: |::..||    ..:.||....:::.|        .|..|.|:||
 Worm   197 SETVMYP-SYK-KWVQSHRDLPIKLNQWCNVVRWEFKH--------PTPFLRTREF 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlnRSNP_524841.1 PLN02859 10..777 CDD:178450 61/316 (19%)
pars-1NP_001370820.1 S15_NS1_EPRS_RNA-bind 14..57 CDD:412325 13/40 (33%)
PRK08661 93..581 CDD:236327 36/188 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111937at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.