powered by:
Protein Alignment GlnRS and LOC103693375
DIOPT Version :9
Sequence 1: | NP_524841.1 |
Gene: | GlnRS / 45786 |
FlyBaseID: | FBgn0027090 |
Length: | 778 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008768835.1 |
Gene: | LOC103693375 / 103693375 |
RGDID: | 9312086 |
Length: | 51 |
Species: | Rattus norvegicus |
Alignment Length: | 30 |
Identity: | 11/30 - (36%) |
Similarity: | 16/30 - (53%) |
Gaps: | 6/30 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 316 KFFLAIKE-----MVEWLGYKP-FKITYSS 339
|.|||.|: :.:|:..|. .||.|:|
Rat 10 KRFLAKKQKQNRPIPQWIRMKTGNKIRYNS 39
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0008 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.