DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlnRS and LOC103690821

DIOPT Version :9

Sequence 1:NP_524841.1 Gene:GlnRS / 45786 FlyBaseID:FBgn0027090 Length:778 Species:Drosophila melanogaster
Sequence 2:XP_008771430.1 Gene:LOC103690821 / 103690821 RGDID:9350894 Length:51 Species:Rattus norvegicus


Alignment Length:30 Identity:11/30 - (36%)
Similarity:16/30 - (53%) Gaps:6/30 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 KFFLAIKE-----MVEWLGYKP-FKITYSS 339
            |.|||.|:     :.:|:..|. .||.|:|
  Rat    10 KRFLAKKQKQNRPIPQWIRMKTGNKIRYNS 39

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlnRSNP_524841.1 PLN02859 10..777 CDD:178450 11/30 (37%)
LOC103690821XP_008771430.1 Ribosomal_L39 9..50 CDD:395670 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.