DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IleRS and MetRS-m

DIOPT Version :9

Sequence 1:NP_524840.2 Gene:IleRS / 45785 FlyBaseID:FBgn0027086 Length:1229 Species:Drosophila melanogaster
Sequence 2:NP_001262564.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster


Alignment Length:622 Identity:126/622 - (20%)
Similarity:207/622 - (33%) Gaps:190/622 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LHYKPLFPY---FAKRGAEV-KAYRVLVDEYV--TEDSGTGIVHNAPYFGEDDYRVCLAAGLITK 353
            ||..|:..|   .::|..|| ::..:..|:::  |||.....|.|.       :|.....|.|..
  Fly    79 LHGVPVAKYCDDISQRYREVFRSASIQQDDFIRTTEDRHKRAVANF-------WRTLHTRGHIYS 136

  Fly   354 S--SEVLCPVDEAGRFTNEASDFEGQYVKDSDKQIMAALKARGNLVSSGQVKHSYPFCWRSDTPL 416
            :  |...|..||.             ::.||..::..|...|.:|.|      .:|..|..:|..
  Fly   137 AAYSGWYCVSDET-------------FLTDSQLRLDEATGTRYSLES------GHPVEWTEETNY 182

  Fly   417 IYKA------VPSWF-----VRVEHMSKNLLDCSSQTYWVPDFVKEKRFGNWLKEARDWAISR-- 468
            :::.      |..|.     ||.....|.|||..|:.  :||.                ::||  
  Fly   183 MFRLSQFQDDVRHWVKTEARVRPAKFEKILLDTLSEP--LPDV----------------SVSRPS 229

  Fly   469 NR-YWGTPIPIWRSPSGDETVVIGSIKQLAELSGVQVEDLHRESIDHIEIPSAVPGNPPLRRIAP 532
            || :|..|:|    ....:||.:.....:..||.|...|   |..                    
  Fly   230 NRVHWAIPVP----DDDSQTVYVWLDALVNYLSSVGYPD---EKF-------------------- 267

  Fly   533 VFDCWFESGSMPFAQQHFPFENEKDFMNNFPADFIAEGIDQTRGWFYTLLVISTALFNKAPFKNL 597
                   |...|.|||                 .|.:.|.:..|.::|..:::..|  :.|.:..
  Fly   268 -------SAHWPPAQQ-----------------VIGKDILKFHGIYWTAFLLAAGL--EPPGQLY 306

  Fly   598 IASGLVLAADGQKMSKRKKNYPDPMEVVHKYGADALRLYLINSPVVRAESLRFKEEGVRDIIKDV 662
            :.|...:  |||||||.|.|..||::...:|..:.||.:|:...|..::.               
  Fly   307 VHSHWTV--DGQKMSKSKHNVVDPLQAAQQYTMEGLRYFLLREGVAHSDG--------------- 354

  Fly   663 FLPWYNAYRFLLQNIVRYEKEDLAGN------------GQ-YTYDRERH----LKNMDKASVIDV 710
                 |......|.|:..|..|..||            || |......|    |:::|.|..:..
  Fly   355 -----NYSHVKAQRILNSELADTLGNLLSRASAKSLNPGQIYPSPSAEHLADLLRSLDVAKRLQD 414

  Fly   711 WILSFKESLLEFFATEMKMYRLY--TVVPRL---TKFIDQLTNWYVRLNRRRIKGELGADQCIQS 770
            .:|...|.....:  |...:.|.  |.:..|   ..|.:....|.::         .||....|:
  Fly   415 SLLQLSERCESHY--ECNHFHLVADTTMAALHAANNFFESSKPWTLK---------AGAPDGNQA 468

  Fly   771 -LDTL----YDVLYTMVKMMAPFTPYLTEYIFQRLVLFQPAG-------TLEHADSVHYQMMPVS 823
             |:|:    .|.|.....::.|..|.|...:..:|.:  |..       ....|.|.:....|..
  Fly   469 RLETIIAMTMDALRLSGIVLQPIIPQLANRLLDKLSV--PTAQRGWNYLAESFATSPNSSNSPAG 531

  Fly   824 QKKFIRNDIERSVALMQSVVE--LGRVMRDRRTLPVK 858
            ..:..:.|.:.|..|.|.::|  ..:.:::::..|.|
  Fly   532 LGESRQLDGQTSALLFQRILEETSAKEVKEQKPQPAK 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IleRSNP_524840.2 PLN02882 9..1094 CDD:215477 126/622 (20%)
IleRS_core 47..>189 CDD:173909
IleRS_core <373..650 CDD:173909 62/290 (21%)
Anticodon_Ia_Ile_ABEc 650..847 CDD:153415 42/232 (18%)
MetRS-mNP_001262564.1 MetRS_core 20..356 CDD:173907 82/395 (21%)
PRK11893 21..553 CDD:237012 123/605 (20%)
Anticodon_Ia_like 365..503 CDD:299868 29/148 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.