DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ThrRS and mrpl39

DIOPT Version :9

Sequence 1:NP_001285868.1 Gene:ThrRS / 45784 FlyBaseID:FBgn0027081 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001011362.1 Gene:mrpl39 / 496829 XenbaseID:XB-GENE-953160 Length:331 Species:Xenopus tropicalis


Alignment Length:328 Identity:81/328 - (24%)
Similarity:144/328 - (43%) Gaps:61/328 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 AKMKKE--KKEKPSGGGDTRKELSPLPKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGKQ 118
            :||..|  .|||     :.:..|.|..:.||.::|               .||:...|.|.:..|
 Frog    33 SKMHTELFNKEK-----ERQLSLHPRIEKIEVKHV---------------GKRDHGAVGLMNKGQ 77

  Fly   119 VDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAV---FW 180
                   :|||..|..:|:.....:|::.|:|||||:.:.|..:|.:|.|.|.|.:.:.|   :|
 Frog    78 -------STPYHCALHLSEWYCSRSVLALVDGEVWDMYKPLTKSCNIQFLTFKDEDPEEVNKAYW 135

  Fly   181 HSSAHIMGEAMERIYGGHLCYG-------PPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKE 238
            .|.|.|:|..:|..:.......       |.|...|.||:.|:..   .:|:...|..::.:.:|
 Frog   136 RSCAMILGCVLENAFKEEYMVNLIRAPEIPVISGAFCYDVVLDSR---LDDWRPTEENLRSLTRE 197

  Fly   239 KQN-------FERLEMKKSDLLEMFKYNEFKVRILNEKVTTD---RTTVYKCGSLIDLCRGPHVR 293
            ..:       ||.||:::....|:|:::.:|:.:..||.:.:   ..||::.|..:||..|||:.
 Frog   198 AHSLIHKDLPFESLEVEEKVAKEIFQHSPYKLIMAEEKASQNPQGLVTVHRFGDFVDLTEGPHIP 262

  Fly   294 HTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKE----WEKLQEEAAKRDHRKIGR 354
            .|...:..::|...|.   ....:|.::|..|:|.  |..||.    |.:|:..:.:....:..:
 Frog   263 RTSFCQQYEVTAGHSL---ANIPSEHVRRFQGLSL--PWHLKAHHTVWNRLRTRSQRLVTEEHNQ 322

  Fly   355 EQE 357
            |.|
 Frog   323 EPE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThrRSNP_001285868.1 PLN02908 79..740 CDD:178496 73/303 (24%)
TGS_ThrRS_N 109..170 CDD:133437 19/60 (32%)
tRNA_SAD 276..323 CDD:197931 12/46 (26%)
ThrRS_core 347..643 CDD:238394 2/11 (18%)
ThrRS_anticodon 643..734 CDD:238437
mrpl39NP_001011362.1 ThrS 38..>323 CDD:333237 77/319 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.