DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ThrRS and ProRS-m

DIOPT Version :9

Sequence 1:NP_001285868.1 Gene:ThrRS / 45784 FlyBaseID:FBgn0027081 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_647737.1 Gene:ProRS-m / 38331 FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster


Alignment Length:454 Identity:82/454 - (18%)
Similarity:153/454 - (33%) Gaps:127/454 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 EEAAKRDHRKIGREQELFFFHEL------SPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVIS 400
            :.|..:...::.|.|:|  ..||      |.|:....|......:..:..:::..::.|.|::..
  Fly    16 KNAVVKQTEQLSRSQKL--LTELGLVKSGSNGTYQIMPMAQRSVDKCIDLVQSNMQQAGGQKITL 78

  Fly   401 PNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGH-----CLIFDNRNRSWRELPLRM 460
            |.:....||..:|...   .::..|...:::...:.:..|.|     .::......|:|:||||:
  Fly    79 PILTPTGLWKKTGRLD---GDISEFYMVRDRSGKQFLMSPTHEEAVTAMLATTSPISYRQLPLRL 140

  Fly   461 ADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLS 525
            ...|...|:||.... ||.|.:.|...|.:.|...|:...|          .||:...::     
  Fly   141 FQIGPKFRDELKTRF-GLMRAKEFLMKDMYSFDVSEETAME----------TYTLVNAAY----- 189

  Fly   526 TRPDNYLGELEQWNDAEKALAESLNEFGMPW-KENPGDGAFYGP------KIDITIMDALKRAHQ 583
               |....:||                 :|: |.|...|...|.      .:.....|.|.:...
  Fly   190 ---DRLFKQLE-----------------VPFVKVNAATGIMGGSVSHEYHYVSPVGEDNLLQCSS 234

  Fly   584 CA------TIQLDFQLPIRFNLSYIADDGEKKRPV-IIHRAILG--------------------- 620
            |.      .::.....|     |..:.|.::.|.| :.|..:||                     
  Fly   235 CGFAGNSEVVKAPASCP-----SCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLNTTGKPQSL 294

  Fly   621 -------SVERMIA----ILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSE 674
                   .:.|:||    :|:.:...:||..|:|..|.:  :||     .|..::|.......:|
  Fly   295 VMGCYGIGITRVIAAALEVLSSDHELRWPKLLAPYDVCL--IGP-----KQGSKEQPEAEVIENE 352

  Fly   675 ADCDAGD---------------TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGE 723
            ...:.|:               |:.|::..|:.......:|||.|....::..:....:|  ||
  Fly   353 LLLNVGEICGHQELLHDDRKELTIGKRLLEAKRLGHPLTIVVGAKSARLDSPKLEVHTSK--GE 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThrRSNP_001285868.1 PLN02908 79..740 CDD:178496 82/454 (18%)
TGS_ThrRS_N 109..170 CDD:133437
tRNA_SAD 276..323 CDD:197931
ThrRS_core 347..643 CDD:238394 63/352 (18%)
ThrRS_anticodon 643..734 CDD:238437 18/96 (19%)
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 82/454 (18%)
ProRS_core_prok 24..313 CDD:238402 59/334 (18%)
ProRS_anticodon_short 328..428 CDD:238438 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.